Dendril
    Dendril Roots
      amirate
      Roots
      amaraamir- · Arabic · to command-atus-ate · Latin · office, domain of
      Words related to amirate
      ameeratevemiratenemirnsheikdomnsheikhnsultanicadjsultannsherifiansultanshipnsheikhansultanatenkhalifakalifnsayyidcaliphalmirzasharifsultanessncaliphnhamzahakimnkaliphnwazirimamatevhafizmukhtaraminmaliknsheikanabbas

      Synonyms & related words for amirate

      Find synonyms, related words, and the definition of amirate. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to amirate

      Explore words related to amirate — words associated with it, words that go with it, and its nearest matches in meaning. Related words include ameerate, emirate, emir, sheikdom, sheikh, sultanic, sultan, sherifian. Click any word to make it the center of the map and keep exploring the web of connections.

      Where does amirate come from?

      The word amirate breaks down into 2 roots of Arabic and Latin origin: amir, from Arabic amara (“to command”); and -ate, from Latin -atus (“office, domain of”). Explore each root to see other English words built from the same source.

      © 2026 Dendril · Credits Explore roots