Dendril
    Dendril Roots
      anacoluthic
      Roots
      an-ana- · Greek · not, un-akolouthoscolouth- · Greek · following, in sequence-ikos-ic · Greek · pertaining to
      Words related to anacoluthic
      anacolutharhetoricnhyperbatonnanacoluthonsnhypallagenantiphrasisnhendiadysnpolysyndetonnbrachylogyadjanacoluthianasyndetonnanadiplosisnenallagenapophasisnantonomasiaantilogyadjrhetoricaladjapostrophicadjsyllepsisnepideicticadjepanorthosisnepanodosnsymplocenhypozeuxisnepanaphoranspeechmakingnspeechifyingvepexegesisepistrophensyncrisis

      Synonyms & related words for anacoluthic

      Find synonyms, related words, and the definition of anacoluthic. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to anacoluthic

      Explore words related to anacoluthic — words associated with it, words that go with it, and its nearest matches in meaning. Related words include anacolutha, rhetoric, hyperbaton, anacoluthons, hypallage, antiphrasis, hendiadys, polysyndeton. Click any word to make it the center of the map and keep exploring the web of connections.

      Where does anacoluthic come from?

      The word anacoluthic breaks down into 3 roots of Greek origin: ana-, from Greek an- (“not, un-”); colouth, from Greek akolouthos (“following, in sequence”); and -ic, from Greek -ikos (“pertaining to”). Explore each root to see other English words built from the same source.

      © 2026 Dendril · Credits Explore roots