Dendril
    Dendril Roots
      chain
      noun
      A series of interconnected rings or links usually made of metal.
      A series of interconnected things.
      A series of stores or businesses with the same brand name.
      (organic chemistry, physical chemistry) A number of atoms in a series, which combine to form a molecule.
      (surveying) A series of interconnected links of known length, used as a measuring device.
      (surveying) A long measuring tape.
      A unit of length, exactly equal to 22 yards, which is 4 rods or 100 links, and approximately equal to 20.12 metres; the length of a Gunter's surveying chain; the length of a cricket pitch.
      (mathematics, set theory, order theory) A totally ordered set, especially a totally ordered subset of a poset.
      (algebraic topology, originally) A formal sum of cells in a CW complex of a certain dimension k (in which case the formal sums are called k'''-chains); a formal sum of simplices or cubes of a certain dimension in a simplical complex or cubical complex (respectively).
      (algebraic topology, homological algebra, more generally) An element of a group (or module) in a chain complex.
      (British) A sequence of linked house purchases, each of which is dependent on the preceding and succeeding purchase (said to be "broken" if a buyer or seller pulls out).
      That which confines, fetters, or secures; a bond.
      (nautical, in the plural) Iron links bolted to the side of a vessel to bold the dead-eyes connected with the shrouds; also, the channels.
      A livery collar, a chain of office.
      (weaving) The warp threads of a web.
      A surname.
      verb
      (transitive) To fasten something with a chain.
      (figurative) To connect as if with a chain, due to dependence, addiction, or other feelings
      (intransitive) To link multiple items together.
      (transitive) To secure someone with fetters.
      (transitive) To obstruct the mouth of a river etc with a chain.
      (figurative) To obligate.
      (computing) To relate data items with a chain of pointers.
      (computing) To be chained to another data item.
      (transitive) To measure a distance using a 66-foot long chain, as in land surveying.
      (transitive, computing, rare, associated with Acorn Computers) To load and automatically run (a program).
      Roots
      catenachain- · Latin · chain
      Synonyms for chain
      catenanconcatenationnenchainvstringvcatenatevcatenationnnecklacenpothooknshacklevgyvefetternmanaclenropenbanglenankletnhandcuffv
      Words related to chain
      chainmanenchainmentncatenanestrandnchokernlinkworktripodalclaspnagraffebraceletsnpendantnsprocketsnloopncofflelavalierenpackthreadnbobstayadjcuffnprolongenjewelrynlatchetnlinksncausaladjenclasp

      Synonyms & related words for chain

      Find synonyms, related words, and the definition of chain — including catena, concatenation, enchain, string, catenate, catenation. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to chain

      Explore words related to chain — words associated with it, words that go with it, and its nearest matches in meaning. Related words include chainman, enchainment, catenane, strand, choker, linkwork, tripodal, clasp. Click any word to make it the center of the map and keep exploring the web of connections.

      Synonyms for chain

      Common synonyms for chain include catena, concatenation, enchain, string, catenate, catenation, necklace, pothook — words that share a close meaning. Hover or tap any word on the map for its definition and part of speech.

      Where does chain come from?

      The word chain breaks down into one root of Latin origin: the root chain-, from Latin catena (“chain”). Explore each root to see other English words built from the same source.

      © 2026 Dendril · Credits Explore roots