Dendril
    Dendril Roots
      clips
      (C Language Integrated Production System) a public-domain software tool for building expert systems.
      (sometimes known as The Official Game of the Planet) a Canadian game show that aired on YTV from 1993 to 1996 and produced by The Robert Essery Organization, as was the case for its sister show, Video & Arcade Top 10, which also aired on YTV at the time.
      a mobile video editing software application created by Apple Inc.
      Words related to clips
      clippingnsnipnvideosnfootagenvideogenicadjsnippetsnouttakesnmontagenintercutsplicedvwebisodeclippedadjtapenbarrettenvideotapentapelinenclampsnbloopersnhairgripnnewsreelnpliersnlopvgrangerizevscisselpaperclipnreelsnfilmstriphairstylesnloopedvfastenersn

      Synonyms & related words for clips

      Find synonyms, related words, and the definition of clips. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to clips

      Explore words related to clips — words associated with it, words that go with it, and its nearest matches in meaning. Related words include clipping, snip, videos, footage, videogenic, snippets, outtakes, montage. Click any word to make it the center of the map and keep exploring the web of connections.

      © 2026 Dendril · Credits Explore roots