Dendril
    Dendril Roots
      flicking
      noun
      a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement
      a short stroke
      a light sharp contact (usually with something flexible)
      verb
      remove with a flick (of the hand)
      touch or hit with a light, quick blow
      cause to make a snapping sound
      twitch or flutter
      shine unsteadily
      throw or toss with a quick motion
      cause to move with a flick
      look through a book or other written material
      flash intermittently
      Words related to flicking
      flickedvflicksnflickernflipadjrifflevmovienthumbnfilmnswipingvglancingvsnapvwagglingvfingertipsnclicknswiperndartingvflickeryadjflackernpokingnflingingvswipedvtwirlingvflyspeckingnforefingernflixflickeringlyadvglancinglyadvtwitchedvswipesvflitsv

      Synonyms & related words for flicking

      Find synonyms, related words, and the definition of flicking. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to flicking

      Explore words related to flicking — words associated with it, words that go with it, and its nearest matches in meaning. Related words include flicked, flicks, flicker, flip, riffle, movie, thumb, film. Click any word to make it the center of the map and keep exploring the web of connections.

      © 2026 Dendril · Credits Explore roots