Dendril
    Dendril Roots
      land
      noun
      The part of Earth which is not covered by oceans or other bodies of water.
      Real estate or landed property; a partitioned and measurable area which is owned and acquired and on which buildings and structures can be built and erected.
      A country or region.
      A person's country of origin and/or homeplace; homeland.
      The soil, in respect to its nature or quality for farming.
      (often in combination) Realm, domain.
      (agriculture) The ground left unploughed between furrows.
      (agriculture) Any of several portions into which a field is divided for ploughing.
      (Ireland, colloquial) A shock or fright.
      (electronics) A conducting area on a board or chip which can be used for connecting wires.
      On a compact disc or similar recording medium, an area of the medium which does not have pits.
      (travel) The non-airline portion of an itinerary. Hotel, tours, cruises, etc.
      (nautical) The lap of the strakes in a clinker-built boat; the lap of plates in an iron vessel; called also landing.
      In any surface prepared with indentations, perforations, or grooves, that part of the surface which is not so treated, such as the level part of a millstone between the furrows.
      (ballistics) The space between the rifling grooves in a gun.
      lant; urine
      A surname from Middle English.
      (obsolete) The ground or floor.
      (Scotland, historical) A group of dwellings or tenements under one roof and having a common entry.
      verb
      (intransitive) To descend to a surface, especially from the air.
      (intransitive) To come into rest.
      (intransitive) To arrive on land, especially a shore or dock, from a body of water.
      (transitive) To bring to land.
      (transitive, informal) To capture or arrest.
      (transitive) To acquire; to secure.
      (slang, transitive) To succeed in having sexual relations with; to score.
      (transitive, of a blow) To deliver.
      (intransitive, of a punch) To connect (to arrive at an intended target).
      (intransitive, figurative) To go down well with an audience.
      (dated) To alight, to descend from a vehicle.
      Synonyms for land
      acresnsoilnestatengroundndemesnenearthnacreagendomainncountrynpropertynrealmn
      Words related to land
      landownershipnfarmlandncroplandsallodiummeadowlandfarmingnlandwardsadvcommonagenpoachyadjcoastlandnpasturelandnlandholdingnarableadjbottomlandntriphibiousadjallodialfarmableadjlandlessadjtractncultivableadjforestlandlandowningtillableadjcarsecultivatableadjoutlandssheepwalkngrasslandnwayleave

      Synonyms & related words for land

      Find synonyms, related words, and the definition of land — including acres, soil, estate, ground, demesne, earth. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to land

      Explore words related to land — words associated with it, words that go with it, and its nearest matches in meaning. Related words include landownership, farmland, croplands, allodium, meadowland, farming, landwards, commonage. Click any word to make it the center of the map and keep exploring the web of connections.

      Synonyms for land

      Common synonyms for land include acres, soil, estate, ground, demesne, earth, acreage, domain — words that share a close meaning. Hover or tap any word on the map for its definition and part of speech.

      © 2026 Dendril · Credits Explore roots