Dendril
    Dendril Roots
      smooth
      noun
      Something that is smooth, or that goes smoothly and easily.
      A smoothing action.
      A domestic animal having a smooth coat.
      A member of an anti-hippie fashion movement in 1970s Britain.
      (statistics) The analysis obtained through a smoothing procedure.
      verb
      (transitive) To make smooth or even.
      (transitive) To reduce to a particular shape or form by pressure; to press, to flatten.
      (transitive) To make straightforward or easy.
      (transitive) To calm or palliate.
      (statistics, image processing, digital audio) To capture important patterns in the data, while leaving out noise.
      (West Country) To stroke; especially to stroke an animal's fur.
      adjective
      Having a texture that lacks friction. Not rough.
      Without difficulty, problems, or unexpected consequences or incidents.
      Bland; glib.
      Flowing or uttered without check, obstruction, or hesitation; not harsh; fluent.
      Suave; sophisticated.
      (of an action) Natural; unconstrained.
      (of a motion) Unbroken.
      (chiefly of water) Placid, calm.
      (of an edge) Lacking projections or indentations; not serrated.
      (of food or drink) Not grainy; having an even texture.
      (of a beverage) Having a pleasantly rounded flavor; neither rough nor astringent.
      (mathematics, of a function) Having derivatives of all finite orders at all points within the function’s domain.
      (mathematics, of a number) That factors completely into small prime numbers.
      (linguistics, classical studies, of a vowel) Lacking marked aspiration.
      (of muscles, medicine) Involuntary and non-striated.
      adverb
      Smoothly.
      Synonyms for smooth
      smoothenvsuaveadjsmoothlyadvglabratevsleekadjunruffledadjsilkyadjslickadjfluentadjsatinyadjquietadjplacidadjtranquiladjsoftadjsuppleadjvelvetyadjseamlessadjblandadjmellowadjeffortlessadjslipperyadjplanishadjpolishedadjgentleadj
      Words related to smooth
      repandadjcreaselessadjlevigatevsmoothnessnmellifluencensilkinessnsinuateadjlubricadjmollifiervlissotrichousadjslicknessnroughhewsleeklyadvsleeknessncrispateadjmellowlyadv

      Synonyms & related words for smooth

      Find synonyms, related words, and the definition of smooth — including smoothen, suave, smoothly, glabrate, sleek, unruffled. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to smooth

      Explore words related to smooth — words associated with it, words that go with it, and its nearest matches in meaning. Related words include repand, creaseless, levigate, smoothness, mellifluence, silkiness, sinuate, lubric. Click any word to make it the center of the map and keep exploring the web of connections.

      Synonyms for smooth

      Common synonyms for smooth include smoothen, suave, smoothly, glabrate, sleek, unruffled, silky, slick — words that share a close meaning. Hover or tap any word on the map for its definition and part of speech.

      © 2026 Dendril · Credits Explore roots