Dendril
    Dendril Roots
      tricking
      noun
      (card games) in a single round, the sequence of cards played by all the players
      a prostitute's customer
      an illusory feat
      a ludicrous or grotesque act done for fun and amusement
      an attempt to get you to do something foolish or imprudent
      a period of work or duty
      a cunning or deceitful action or device
      verb
      deceive somebody
      Words related to tricking
      deceptionntrickedvtrickishadjfoolingadjtricksometricklessadjhoodwinkingvdeceivingvdupingntricksnpranknduperynouttrickswindlingvtrickerynphenakismndeceivesvfooledvbefoolvtrickerndeceptibleadjdeceivableadjdupedvhoodwinkervmanipulatingvunfooleddeceptibilitynrusenknackishadjfubberyadj

      Synonyms & related words for tricking

      Find synonyms, related words, and the definition of tricking. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to tricking

      Explore words related to tricking — words associated with it, words that go with it, and its nearest matches in meaning. Related words include deception, tricked, trickish, fooling, tricksome, trickless, hoodwinking, deceiving. Click any word to make it the center of the map and keep exploring the web of connections.

      © 2026 Dendril · Credits Explore roots