Dendril
    Dendril Roots
      types
      noun
      A grouping based on shared characteristics; a class.
      An individual considered typical of its class, one regarded as typifying a certain profession, environment, etc.
      An individual that represents the ideal for its class; an embodiment.
      (printing, countable) A letter or character used for printing, historically a cast or engraved block.
      (uncountable) Such types collectively, or a set of type of one font or size.
      (chiefly uncountable) Text printed with such type, or imitating its characteristics.
      (computing theory) A tag attached to variables and values used in determining which kinds of value can be used in which situations; a data type.
      (taxonomy) Something, often a specimen, selected as an objective anchor to connect a scientific name to a taxon; this need not be representative or typical.
      (medicine) A blood group.
      (corpus linguistics) A word that occurs in a text or corpus irrespective of how many times it occurs, as opposed to a token.
      (theology) An event or person that prefigures or foreshadows a later event - commonly an Old Testament event linked to Christian times.
      (fine arts) The original object, or class of objects, scene, face, or conception, which becomes the subject of a copy; especially, the design on the face of a medal or a coin.
      (chemistry) A simple compound, used as a mode or pattern to which other compounds are conveniently regarded as being related, and from which they may be actually or theoretically derived.
      (mathematics) A part of the partition of the object domain of a logical theory (which due to the existence of such partition, would be called a typed theory). (Note: this corresponds to the notion of "data type" in computing theory.)
      Preferred sort of person; sort of person that one is attracted to.
      (obsolete except in the above special senses) A symbol, emblem, or example of something.
      verb
      To categorize into types.
      To put text on paper using a typewriter.
      To enter text or commands into a computer using a keyboard.
      To determine the blood type of.
      To represent by a type, model, or symbol beforehand; to prefigure.
      To furnish an expression or copy of; to represent; to typify.
      adverb
      (African-American Vernacular, slang, rare) Very, extremely.
      Roots
      typteintyp- · Greek · to strike, beat
      Words related to types
      countertypekindsntypewritevtypalsortsnheteromerousadjtypecastvtypecasevarietynkeitloasubtypenomnifariousadjvariousadjcharacteristicsndiversiformsuchlikeadjcategoriesndifferentadjcharacternassortedadjvariformadjpretypifyvassortervilknmultiformityntypologyntypicalnessnantitypenotheradjmiscellaneousadj

      Synonyms & related words for types

      Find synonyms, related words, and the definition of types. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to types

      Explore words related to types — words associated with it, words that go with it, and its nearest matches in meaning. Related words include countertype, kinds, typewrite, typal, sorts, heteromerous, typecast, typecase. Click any word to make it the center of the map and keep exploring the web of connections.

      Where does types come from?

      The word types breaks down into one root of Greek origin: the root typ-, from Greek typtein (“to strike, beat”). Explore each root to see other English words built from the same source.

      © 2026 Dendril · Credits Explore roots