Dendril
    Dendril Roots
      vestiges
      Roots
      vestigiumvestig- · Latin · track, footprint
      Words related to vestiges
      tracenremnantsnrelicsnvestigialadjvestigiallyadvrelictsnremainsnresiduenbygoneadjreliqueruinsneffacedvnonresidualleftoveradjineffaceableadjmolderingvtracelessadjeffacerverasedvremanentadjvanishedadjleavingsnresidualadjextantadjlingeringnintactadjfragmentsnerasesvwreckagenerasionn

      Synonyms & related words for vestiges

      Find synonyms, related words, and the definition of vestiges. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to vestiges

      Explore words related to vestiges — words associated with it, words that go with it, and its nearest matches in meaning. Related words include trace, remnants, relics, vestigial, vestigially, relicts, remains, residue. Click any word to make it the center of the map and keep exploring the web of connections.

      Where does vestiges come from?

      The word vestiges breaks down into one root of Latin origin: the root vestig-, from Latin vestigium (“track, footprint”). Explore each root to see other English words built from the same source.

      © 2026 Dendril · Credits Explore roots