Dendril
    Dendril Roots
      kingdom
      noun
      A realm having a king or queen as its actual or nominal sovereign.
      A realm, region, or conceptual space where something is dominant.
      (taxonomy) A rank in the classification of organisms, below domain and above phylum; a taxon at that rank (e.g. the plant kingdom, the animal kingdom).
      Synonyms for kingdom
      realmnmonarchynsultanatenprincipalitynsubkingdomnlandnemperyadjduchynempirendukedomn
      Words related to kingdom
      kingshipnqueendomnkinglessadjkingnkinghoodnkinglyadjkinglinessnmonarchnprincesnprincedomnsovereignadjroyaladjprincelinessnthronenuncrownkingcraftregalitynprincelyadjreignnmajestynmonarchicadjprincessesndiscrownregaladjregnantadjrulernmonarchicaladjqueennqueenshipndominionsn

      Synonyms & related words for kingdom

      Find synonyms, related words, and the definition of kingdom — including realm, monarchy, sultanate, principality, subkingdom, land. Dendril is a free visual thesaurus that shows them on an interactive map where stronger matches sit closer to the center — no signup, no ads.

      Words related to kingdom

      Explore words related to kingdom — words associated with it, words that go with it, and its nearest matches in meaning. Related words include kingship, queendom, kingless, king, kinghood, kingly, kingliness, monarch. Click any word to make it the center of the map and keep exploring the web of connections.

      Synonyms for kingdom

      Common synonyms for kingdom include realm, monarchy, sultanate, principality, subkingdom, land, empery, duchy — words that share a close meaning. Hover or tap any word on the map for its definition and part of speech.

      © 2026 Dendril · Credits Explore roots